PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g18130.5
Common NameLR48_Vigan01g318400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ZF-HD
Protein Properties Length: 215aa    MW: 24320.7 Da    PI: 9.0756
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g18130.5genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.65.2e-321066259
     ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                    ++vrY+eClkNhAa++Gg+a+DGCgEfmps geegt++al+C+AC CHRnFHR+eve 
  Vang11g18130.5 10 KAVRYRECLKNHAAAMGGNATDGCGEFMPS-GEEGTIEALNCSACHCHRNFHRKEVEG 66
                    689**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-251275IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.7E-281264IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.0E-301364IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.331463IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.605.5E-31134207IPR009057Homeodomain-like
SuperFamilySSF466891.04E-19138206IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-27145201IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MHQEDHGYKK AVRYRECLKN HAAAMGGNAT DGCGEFMPSG EEGTIEALNC SACHCHRNFH  60
RKEVEGEPSS CDYHPFNRRR LILGPHKNLL PPEALGYPTG NILPSRSVPP HQMIMPYSIG  120
HLPSESDEQE DGGGMVQPRP SQLVKKRFRT KFTQEQKEKM LNFAERVGWK IQKQEESVVQ  180
QFCQEIGVKR RVLKVWMHNN KHNLAKKNPP TAAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A1e-241442031675ZF-HD homeobox family protein
1wh7_A1e-241462031875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014505756.11e-158PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotQ9M9S01e-75ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A0L9TSQ21e-160A0A0L9TSQ2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R9F51e-160A0A0S3R9F5_PHAAN; Uncharacterized protein
STRINGGLYMA07G40190.11e-122(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.28e-77homeobox protein 31
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]